PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr012357.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 308aa    MW: 34747.8 Da    PI: 7.026
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr012357.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding231.9e-072872345
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                      WT eE +l+ +a +++ ++   +W ++a++++ g+t  +++  + 
      Pbr012357.1 28 EWTVEENKLFENALALYDKDtpdRWLRVAAMIP-GKTVGDVIKQYK 72
                     5********************************.****99988775 PP

2Myb_DNA-binding44.14.8e-14135179347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
      Pbr012357.1 135 PWTEEEHRQFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 179
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.9382479IPR017884SANT domain
SMARTSM007171.0E-82577IPR001005SANT/Myb domain
SuperFamilySSF466891.05E-102881IPR009057Homeodomain-like
CDDcd001673.49E-72874No hitNo description
PfamPF002493.8E-62872IPR001005SANT/Myb domain
PROSITE profilePS5129420.897128184IPR017930Myb domain
SuperFamilySSF466896.5E-17130183IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-17131183IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.1E-12132179IPR009057Homeodomain-like
SMARTSM007173.5E-13132182IPR001005SANT/Myb domain
CDDcd001673.96E-11135180No hitNo description
PfamPF002492.0E-12135179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MFRGMEIPSP TSYLQNSNWL FEESTGAEWT VEENKLFENA LALYDKDTPD RWLRVAAMIP  60
GKTVGDVIKQ YKELEEDVSD IEAGLIPIPG YISNNFTTEW VNNQGFDGLE QFYSVGGKRS  120
ASTRPADQER KKGVPWTEEE HRQFLMGLKK YGKGDWRNIS RNFVITRTPT QVASHAQKYF  180
IRQLTGGKDK RRSSIHDITT VNLPDVKPAS PDSTSKSPPS SNHSSTVVQQ RHQHQKLASM  240
SIDWKSPDEG QQMVFGSANG NNFMGPFCGM SSHVPKLEEQ NFLSGNLHGS QLGHYNACFE  300
MQSMRYQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-162591773RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2461630.0GQ246163.1 Malus x domestica cultivar Jiangsu Fuji MYB transcription factor (MYB53) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009370204.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-115DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLE7BJY50.0E7BJY5_MALDO; MYB transcription factor (Fragment)
STRINGPOPTR_0006s09860.11e-154(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-119MYB family protein